Anti-PLAUR, Rabbit, Polyclonal

Artikelnummer: ATA-HPA050843
Artikelname: Anti-PLAUR, Rabbit, Polyclonal
Artikelnummer: ATA-HPA050843
Hersteller Artikelnummer: HPA050843
Alternativnummer: ATA-HPA050843-25,ATA-HPA050843-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD87, UPAR, URKR, Pan-Cancer
plasminogen activator, urokinase receptor
Anti-PLAUR
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5329
UniProt: Q03405
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLAUR
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity as expected.
HPA050843
HPA050843
HPA050843