Anti-p53, Rabbit, Polyclonal

Artikelnummer: ATA-HPA051244
Artikelname: Anti-p53, Rabbit, Polyclonal
Artikelnummer: ATA-HPA051244
Hersteller Artikelnummer: HPA051244
Alternativnummer: ATA-HPA051244-25,ATA-HPA051244-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TP53, LFS1, Pan-Cancer
tumor protein p53
Anti-p53
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 7157
UniProt: P04637
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TP53
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Western blot analysis in human cell line U-251 MG and human cell line PC-3.
HPA051244
HPA051244