Anti-PLK1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA051638
Artikelname: Anti-PLK1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA051638
Hersteller Artikelnummer: HPA051638
Alternativnummer: ATA-HPA051638-25,ATA-HPA051638-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PLK, Pan-Cancer
polo-like kinase 1
Anti-PLK1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5347
UniProt: P53350
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLK1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
HPA051638