Anti-MAP1LC3A, Rabbit, Polyclonal

Artikelnummer: ATA-HPA052474
Artikelname: Anti-MAP1LC3A, Rabbit, Polyclonal
Artikelnummer: ATA-HPA052474
Hersteller Artikelnummer: HPA052474
Alternativnummer: ATA-HPA052474-25,ATA-HPA052474-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3, Pan-Cancer
microtubule-associated protein 1 light chain 3 alpha
Anti-MAP1LC3A
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 84557
UniProt: Q9H492
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MAP1LC3A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in neuronal cells.
HPA052474