Anti-MAP1LC3A, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA052474
Artikelname: |
Anti-MAP1LC3A, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA052474 |
Hersteller Artikelnummer: |
HPA052474 |
Alternativnummer: |
ATA-HPA052474-25,ATA-HPA052474-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3, Pan-Cancer |
microtubule-associated protein 1 light chain 3 alpha |
Klonalität: |
Polyclonal |
Konzentration: |
0.5 mg/ml |
Isotyp: |
IgG |
NCBI: |
84557 |
UniProt: |
Q9H492 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
MAP1LC3A |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:200 - 1:500 |
|
Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in neuronal cells. |
|
HPA052474 |