Anti-MME, Rabbit, Polyclonal

Artikelnummer: ATA-HPA052583
Artikelname: Anti-MME, Rabbit, Polyclonal
Artikelnummer: ATA-HPA052583
Hersteller Artikelnummer: HPA052583
Alternativnummer: ATA-HPA052583-25,ATA-HPA052583-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CALLA, CD10, NEP, Pan-Cancer
membrane metallo-endopeptidase
Anti-MME
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4311
UniProt: P08473
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MME
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000
Immunohistochemistry analysis in human duodenum and cerebral cortex tissues using Anti-MME antibody. Corresponding MME RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, prostate and small intestine using Anti-MME antibody HPA052583 (A) shows similar protein distribution across tissues to independent antibody HPA056072 (B).
Immunohistochemical staining of human duodenum shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human small intestine using Anti-MME antibody HPA052583.
Immunohistochemical staining of human kidney using Anti-MME antibody HPA052583.
Immunohistochemical staining of human prostate using Anti-MME antibody HPA052583.
HPA052583
HPA052583
HPA052583