Anti-TIMP1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA053417
Artikelname: Anti-TIMP1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA053417
Hersteller Artikelnummer: HPA053417
Alternativnummer: ATA-HPA053417-25,ATA-HPA053417-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLGI, EPO, TIMP, Pan-Cancer
TIMP metallopeptidase inhibitor 1
Anti-TIMP1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 7076
UniProt: P01033
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TIMP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
HPA053417
HPA053417
HPA053417