Anti-IL2RA, Rabbit, Polyclonal

Artikelnummer: ATA-HPA054622
Artikelname: Anti-IL2RA, Rabbit, Polyclonal
Artikelnummer: ATA-HPA054622
Hersteller Artikelnummer: HPA054622
Alternativnummer: ATA-HPA054622-25,ATA-HPA054622-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD25, IDDM10, IL2R, Pan-Cancer
interleukin 2 receptor, alpha
Anti-IL2RA
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3559
UniProt: P01589
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IL2RA
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using HPA054622 antibody. Corresponding IL2RA RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemical staining of human lymph node shows strong membranous positivity in non-germinal center cells.
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
HPA054622
HPA054622
HPA054622