Anti-JUN, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA059474
| Artikelname: |
Anti-JUN, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA059474 |
| Hersteller Artikelnummer: |
HPA059474 |
| Alternativnummer: |
ATA-HPA059474-25,ATA-HPA059474-100 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
AP-1, c-Jun, Pan-Cancer |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
3725 |
| UniProt: |
P05412 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
METTFYDDALSFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
JUN |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
![]()
|
HPA059474 |
