Anti-CD5, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA060839
- Bilder (6)
| Artikelname: | Anti-CD5, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA060839 |
| Hersteller Artikelnummer: | HPA060839 |
| Alternativnummer: | ATA-HPA060839-25,ATA-HPA060839-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LEU1, T1, Pan-Cancer |
| CD5 molecule |
| Anti-CD5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 921 |
| UniProt: | P06127 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCQEQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-CD5 antibody. Corresponding CD5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
HPA060839 |
|
|
HPA060839 |
|
|
HPA060839 |
Produktgarantie und fachkundiger Support
