Anti-ITGA2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA060991
Artikelname: Anti-ITGA2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA060991
Hersteller Artikelnummer: HPA060991
Alternativnummer: ATA-HPA060991-25,ATA-HPA060991-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD49B, Pan-Cancer
integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Anti-ITGA2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3673
UniProt: P17301
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITGA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human endometrium, rectum, skin and urinary bladder using Anti-ITGA2 antibody HPA060991 (A) shows similar protein distribution across tissues to independent antibody HPA063556 (B).
Immunohistochemical staining of human liver shows weak membranous positivity in hepatocytes.
Immunohistochemical staining of human urinary bladder shows moderate to strong membranous positivity in urothelial cells.
Immunohistochemical staining of human rectum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human skin shows moderate to strong membranous positivity in squamous epithelial cells.
HPA060991
HPA060991
HPA060991