Anti-GAPDH, Rabbit, Polyclonal

Artikelnummer: ATA-HPA061280
Artikelname: Anti-GAPDH, Rabbit, Polyclonal
Artikelnummer: ATA-HPA061280
Hersteller Artikelnummer: HPA061280
Alternativnummer: ATA-HPA061280-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GAPD, Pan-Cancer
glyceraldehyde-3-phosphate dehydrogenase
Anti-GAPDH
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 2597
UniProt: P04406
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GAPDH
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane, plasma membrane & cytosol.
Western blot analysis using Anti-GAPDH antibody HPA061280 (A) shows similar pattern to independent antibody HPA040067 (B).
HPA061280
HPA061280