Anti-FOXO3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA063104
Artikelname: Anti-FOXO3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA063104
Hersteller Artikelnummer: HPA063104
Alternativnummer: ATA-HPA063104-25,ATA-HPA063104-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AF6q21, FKHRL1, FOXO2, FOXO3A, Pan-Cancer
forkhead box O3
Anti-FOXO3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 2309
UniProt: O43524
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSVVNQNLLHHQHQTQGALGGSRALS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FOXO3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm.
HPA063104