Anti-NOTCH1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA067168
Artikelname: Anti-NOTCH1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA067168
Hersteller Artikelnummer: HPA067168
Alternativnummer: ATA-HPA067168-25,ATA-HPA067168-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TAN1, Pan-Cancer
notch 1
Anti-NOTCH1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4851
UniProt: P46531
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NOTCH1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm.
HPA067168