Anti-ITGB1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA069003
Artikelname: Anti-ITGB1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA069003
Hersteller Artikelnummer: HPA069003
Alternativnummer: ATA-HPA069003-25,ATA-HPA069003-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD29, FNRB, GPIIA, MDF2, MSK12, Pan-Cancer
integrin subunit beta 1
Anti-ITGB1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3688
UniProt: P05556
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITGB1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human smooth muscle and pancreas tissues using Anti-ITGB1 antibody. Corresponding ITGB1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human smooth muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA069003
HPA069003
HPA069003