Anti-VCAM1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA069867
Artikelname: |
Anti-VCAM1, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA069867 |
Hersteller Artikelnummer: |
HPA069867 |
Alternativnummer: |
ATA-HPA069867-25,ATA-HPA069867-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CD106, Pan-Cancer |
vascular cell adhesion molecule 1 |
Klonalität: |
Polyclonal |
Konzentration: |
0.2 mg/ml |
Isotyp: |
IgG |
NCBI: |
7412 |
UniProt: |
P19320 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
VCAM1 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions. |
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
HPA069867 |
|
HPA069867 |