Anti-BRAF, Rabbit, Polyclonal

Artikelnummer: ATA-HPA071048
Artikelname: Anti-BRAF, Rabbit, Polyclonal
Artikelnummer: ATA-HPA071048
Hersteller Artikelnummer: HPA071048
Alternativnummer: ATA-HPA071048-25,ATA-HPA071048-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BRAF1, Pan-Cancer
B-Raf proto-oncogene, serine/threonine kinase
Anti-BRAF
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 673
UniProt: P15056
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BRAF
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
HPA071048
HPA071048