Anti-KIT, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA073252
Artikelname: |
Anti-KIT, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA073252 |
Hersteller Artikelnummer: |
HPA073252 |
Alternativnummer: |
ATA-HPA073252-25,ATA-HPA073252-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
C-Kit, CD117, PBT, SCFR, Pan-Cancer |
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog |
Klonalität: |
Polyclonal |
Konzentration: |
0.3 mg/ml |
Isotyp: |
IgG |
NCBI: |
3815 |
UniProt: |
P10721 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
KIT |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml |
|
Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane. |
|
HPA073252 |