Anti-KIT, Rabbit, Polyclonal

Artikelnummer: ATA-HPA073252
Artikelname: Anti-KIT, Rabbit, Polyclonal
Artikelnummer: ATA-HPA073252
Hersteller Artikelnummer: HPA073252
Alternativnummer: ATA-HPA073252-25,ATA-HPA073252-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C-Kit, CD117, PBT, SCFR, Pan-Cancer
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Anti-KIT
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 3815
UniProt: P10721
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIT
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane.
HPA073252