Recombinant Mouse Apolipoprotein C-III (Apoc3), Unconjugated

Artikelnummer: BIM-RPC20003
Artikelname: Recombinant Mouse Apolipoprotein C-III (Apoc3), Unconjugated
Artikelnummer: BIM-RPC20003
Hersteller Artikelnummer: RPC20003
Alternativnummer: BIM-RPC20003-20UG, BIM-RPC20003-100UG, BIM-RPC20003-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Apolipoprotein C3
Recombinant Mouse Apolipoprotein C-III (Apoc3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Apoc3. Target Synonyms: Apolipoprotein C3. A
Molekulargewicht: 24.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
Target-Kategorie: Apoc3