Recombinant Mouse Apolipoprotein E (Apoe), Unconjugated

Artikelnummer: BIM-RPC20004
Artikelname: Recombinant Mouse Apolipoprotein E (Apoe), Unconjugated
Artikelnummer: BIM-RPC20004
Hersteller Artikelnummer: RPC20004
Alternativnummer: BIM-RPC20004-20UG, BIM-RPC20004-100UG, BIM-RPC20004-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: ApoeApolipoprotein E, Apo-E
Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Apoe. Target Synonyms: ApoeApolipoprotein E, Apo-
Molekulargewicht: 38kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLK
Target-Kategorie: Apoe