Recombinant Human Aquaporin-1 (AQP1), partial, Unconjugated

Artikelnummer: BIM-RPC20005
Artikelname: Recombinant Human Aquaporin-1 (AQP1), partial, Unconjugated
Artikelnummer: BIM-RPC20005
Hersteller Artikelnummer: RPC20005
Alternativnummer: BIM-RPC20005-20UG, BIM-RPC20005-100UG, BIM-RPC20005-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Aquaporin-CHIP, Urine water channel, Water channel protein for red blood cells and kidney proximal tubule
Recombinant Human Aquaporin-1 (AQP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: AQP1. Target Synonyms: Aquaporin-CHIP, Urine
Molekulargewicht: 21.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Target-Kategorie: AQP1