Recombinant Rat Osteocalcin (Bglap), Unconjugated

Artikelnummer: BIM-RPC20010
Artikelname: Recombinant Rat Osteocalcin (Bglap), Unconjugated
Artikelnummer: BIM-RPC20010
Hersteller Artikelnummer: RPC20010
Alternativnummer: BIM-RPC20010-20UG, BIM-RPC20010-100UG, BIM-RPC20010-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Bone Gla protein, BGPGamma-carboxyglutamic acid-containing protein
Recombinant Rat Osteocalcin (Bglap) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Bglap. Target Synonyms: Bone Gla protein, BGPGamma-c
Molekulargewicht: 32.6kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Target-Kategorie: Bglap