Recombinant Human Bone morphogenetic protein 4 (BMP4), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Bone morphogenetic protein 4 (BMP4), Unconjugated
• Artikelnummer: BIM-RPC20011
• Hersteller Artikelnummer: RPC20011
• Alternativnummer: BIM-RPC20011-20UG, BIM-RPC20011-100UG, BIM-RPC20011-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Bone morphogenetic protein 2B, BMP-2B

Produktbeschreibung

Recombinant Human Bone morphogenetic protein 4 (BMP4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: BMP4. Target Synonyms: Bone morphogen

Produkteigenschaften

• Molekulargewicht: 29.1kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
• Target-Kategorie: BMP4