Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3), Unconjugated
• Artikelnummer: BIM-RPC20012
• Hersteller Artikelnummer: RPC20012
• Alternativnummer: BIM-RPC20012-20UG, BIM-RPC20012-100UG, BIM-RPC20012-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: BRCA1-A complex subunit BRCC36BRCA1/BRCA2-containing complex subunit 3BRCA1/BRCA2-containing complex subunit 36BRISC complex subunit BRCC36

Produktbeschreibung

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: BRCC3. Target Synonyms: BRC

Produkteigenschaften

• Molekulargewicht: 51.9kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTH
• Target-Kategorie: BRCC3