Recombinant Human Cystathionine beta-synthase (CBS), partial, Unconjugated

Artikelnummer: BIM-RPC20017
Artikelname: Recombinant Human Cystathionine beta-synthase (CBS), partial, Unconjugated
Artikelnummer: BIM-RPC20017
Hersteller Artikelnummer: RPC20017
Alternativnummer: BIM-RPC20017-20UG, BIM-RPC20017-100UG, BIM-RPC20017-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Beta-thionase, Serine sulfhydrase
Recombinant Human Cystathionine beta-synthase (CBS), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CBS. Target Synonyms: Beta-thi
Molekulargewicht: 64.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASV
Target-Kategorie: CBS