Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial, Unconjugated

Artikelnummer: BIM-RPC20024
Artikelname: Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial, Unconjugated
Artikelnummer: BIM-RPC20024
Hersteller Artikelnummer: RPC20024
Alternativnummer: BIM-RPC20024-20UG, BIM-RPC20024-100UG, BIM-RPC20024-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Chrna1, Acra, Acetylcholine receptor subunit alpha
Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Chrna1. Target Syn
Molekulargewicht: 28.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
Target-Kategorie: Chrna1