Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated

Produktübersicht

• Artikelname: Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated
• Artikelnummer: BIM-RPC20026
• Hersteller Artikelnummer: RPC20026
• Alternativnummer: BIM-RPC20026-20UG, BIM-RPC20026-100UG, BIM-RPC20026-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Konjugation: Unconjugated
• Alternative Synonym: CHRNA1, Acetylcholine receptor subunit alpha

Produktbeschreibung

Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Tetronarce californica (Pacific elec

Produkteigenschaften

• Molekulargewicht: 40.8kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
• Target-Kategorie: CHRNA1