Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR), partial, Unconjugated

Artikelnummer: BIM-RPC20050
Artikelname: Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR), partial, Unconjugated
Artikelnummer: BIM-RPC20050
Hersteller Artikelnummer: RPC20050
Alternativnummer: BIM-RPC20050-20UG, BIM-RPC20050-100UG, BIM-RPC20050-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 3 hydroxy 3 methylglutaryl CoA reductase, 3 hydroxy 3 methylglutaryl Coenzyme A reductase, 3 hydroxymethylglutaryl CoA reductase, 3-hydroxy-3-methylglutaryl CoA reductase (NADPH), 3-hydroxy-3-methylglutaryl-coenzyme A reductase, 3H3M, HMDH_HUMAN, HMG CoA
Recombinant Human 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HMGCR. T
Molekulargewicht: 36kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARI
Target-Kategorie: HMGCR