Recombinant Human Indolethylamine N-methyltransferase (INMT), Unconjugated

Artikelnummer: BIM-RPC20053
Artikelname: Recombinant Human Indolethylamine N-methyltransferase (INMT), Unconjugated
Artikelnummer: BIM-RPC20053
Hersteller Artikelnummer: RPC20053
Alternativnummer: BIM-RPC20053-20UG, BIM-RPC20053-100UG, BIM-RPC20053-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Aromatic alkylamine N-methyltransferase, Amine N-methyltransferase, Arylamine N-methyltransferaseThioether S-methyltransferase, TEMT
Recombinant Human Indolethylamine N-methyltransferase (INMT) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: INMT. Target Synonyms: Aromati
Molekulargewicht: 44.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCF
Target-Kategorie: INMT