Recombinant Human Galectin-9 (LGALS9), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Galectin-9 (LGALS9), Unconjugated
• Artikelnummer: BIM-RPC20057
• Hersteller Artikelnummer: RPC20057
• Alternativnummer: BIM-RPC20057-20UG, BIM-RPC20057-100UG, BIM-RPC20057-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Ecalectin, Tumor antigen HOM-HD-21

Produktbeschreibung

Recombinant Human Galectin-9 (LGALS9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LGALS9. Target Synonyms: Ecalectin, Tumor antigen HOM

Produkteigenschaften

• Molekulargewicht: 65.9kDa
• Tag: N-Terminal 6Xhis-Gst-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNS
• Target-Kategorie: LGALS9