Recombinant Human Retinoschisin (RS1), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Retinoschisin (RS1), Unconjugated
• Artikelnummer: BIM-RPC20075
• Hersteller Artikelnummer: RPC20075
• Alternativnummer: BIM-RPC20075-20UG, BIM-RPC20075-100UG, BIM-RPC20075-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: X-linked juvenile retinoschisis protein

Produktbeschreibung

Recombinant Human Retinoschisin (RS1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RS1. Target Synonyms: X-linked juvenile retinoschisis

Produkteigenschaften

• Molekulargewicht: 27kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
• Target-Kategorie: RS1