Recombinant Mycobacterium tuberculosis Putative amidase AmiB2 (amiB2), Unconjugated

Artikelnummer: BIM-RPC20549
Artikelname: Recombinant Mycobacterium tuberculosis Putative amidase AmiB2 (amiB2), Unconjugated
Artikelnummer: BIM-RPC20549
Hersteller Artikelnummer: RPC20549
Alternativnummer: BIM-RPC20549-20UG, BIM-RPC20549-100UG, BIM-RPC20549-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: amiB2, Rv1263, MTCY50.19cPutative amidase AmiB2, EC 3.5.1.4
Recombinant Mycobacterium tuberculosis Putative amidase AmiB2 (amiB2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv).
Molekulargewicht: 69.1kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQFDRARAEAEAAQQRLDAGERLPLLGVPIAIKDDVDIAGEVTTYGSAGHGPAATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNRTPGGSSGGSAAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRISLEPHDGAWQGLSVNGPIARSVMDAALLLDATTTVPGPEGEFVAAAARQPGRLRI
Target-Kategorie: amiB2