Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial, Unconjugated

Artikelnummer: BIM-RPC20550
Artikelname: Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial, Unconjugated
Artikelnummer: BIM-RPC20550
Hersteller Artikelnummer: RPC20550
Alternativnummer: BIM-RPC20550-20UG, BIM-RPC20550-100UG, BIM-RPC20550-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Jumonji domain-containing protein 1CThyroid receptor-interacting protein 8
Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Tar
Molekulargewicht: 45.5kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Target-Kategorie: JMJD1C