Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial, Unconjugated

Artikelnummer: BIM-RPC20551
Artikelname: Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial, Unconjugated
Artikelnummer: BIM-RPC20551
Hersteller Artikelnummer: RPC20551
Alternativnummer: BIM-RPC20551-20UG, BIM-RPC20551-100UG, BIM-RPC20551-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: JmjC domain-containing histone demethylation protein 2BJumonji domain-containing protein 1BNuclear protein 5qNCA
Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KDM3B. Target Synonyms: J
Molekulargewicht: 45.6kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR
Target-Kategorie: KDM3B