Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA), Unconjugated

Artikelnummer: BIM-RPC20554
Artikelname: Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA), Unconjugated
Artikelnummer: BIM-RPC20554
Hersteller Artikelnummer: RPC20554
Alternativnummer: BIM-RPC20554-20UG, BIM-RPC20554-100UG, BIM-RPC20554-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: 2-ketoacid reductase
Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Escherichia coli (strain 55989 / EAEC). Target Name
Molekulargewicht: 51.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFN
Target-Kategorie: ghrA