Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated

Artikelnummer: BIM-RPC20565
Artikelname: Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated
Artikelnummer: BIM-RPC20565
Hersteller Artikelnummer: RPC20565
Alternativnummer: BIM-RPC20565-20UG, BIM-RPC20565-100UG, BIM-RPC20565-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Clinically amyopathic dermatomyositis autoantigen 140 kDaCADM-140 autoantigenHelicase with 2 CARD domainsHelicardInterferon-induced with helicase C domain protein 1Melanoma differentiation-associated protein 5MDA-5Murabutide down-regulated proteinRIG-I-l
Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name
Molekulargewicht: 53.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: KLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCAD
Target-Kategorie: IFIH1