Recombinant Human PCNA-associated factor (PCLAF), Unconjugated

Artikelnummer: BIM-RPC21560
Artikelname: Recombinant Human PCNA-associated factor (PCLAF), Unconjugated
Artikelnummer: BIM-RPC21560
Hersteller Artikelnummer: RPC21560
Alternativnummer: BIM-RPC21560-20UG, BIM-RPC21560-100UG, BIM-RPC21560-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Hepatitis C virus NS5A-transactivated protein 9, HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1, OEATC-1, PCNA-associated factor of 15 kDa, PAF15, p15PAF
Recombinant Human PCNA-associated factor (PCLAF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PCLAF. Target Synonyms: Hepatitis C virus
Molekulargewicht: 39kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Target-Kategorie: PCLAF