Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial, Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial, Unconjugated
• Artikelnummer: BIM-RPC24767
• Hersteller Artikelnummer: RPC24767
• Alternativnummer: BIM-RPC24767-20UG, BIM-RPC24767-100UG, BIM-RPC24767-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Janus kinase 1JAK-1

Produktbeschreibung

Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: JAK1. Target Synonyms: Janus k

Produkteigenschaften

• Molekulargewicht: 36.9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: EQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTR
• Target-Kategorie: JAK1