Recombinant Human Melanoma-associated antigen 1 (MAGEA1), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Melanoma-associated antigen 1 (MAGEA1), Unconjugated
• Artikelnummer: BIM-RPC24802
• Hersteller Artikelnummer: RPC24802
• Alternativnummer: BIM-RPC24802-20UG, BIM-RPC24802-100UG, BIM-RPC24802-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Antigen MZ2-ECancer/testis antigen 1.1, CT1.1MAGE-1 antigen

Produktbeschreibung

Recombinant Human Melanoma-associated antigen 1 (MAGEA1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MAGEA1. Target Synonyms: Antigen MZ2

Produkteigenschaften

• Molekulargewicht: 36.3kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQV
• Target-Kategorie: MAGEA1