Recombinant Mouse Microtubule-associated protein tau (Mapt), Unconjugated

Produktübersicht

• Artikelname: Recombinant Mouse Microtubule-associated protein tau (Mapt), Unconjugated
• Artikelnummer: BIM-RPC24806
• Hersteller Artikelnummer: RPC24806
• Alternativnummer: BIM-RPC24806-20UG, BIM-RPC24806-100UG, BIM-RPC24806-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Konjugation: Unconjugated
• Alternative Synonym: Neurofibrillary tangle proteinPaired helical filament-tauPHF-tau

Produktbeschreibung

Recombinant Mouse Microtubule-associated protein tau (Mapt) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mapt. Target Synonyms: Neurofibri

Produkteigenschaften

• Molekulargewicht: 78.1kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: ADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESPPQPPADDGAEEPGSETSDAKSTPTAEDVTAPLVDERAPDKQAAAQPHTEIPEGITAEEAGIGDTPNQEDQAAGHVTQGRREGQAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTRPEDIEKSHPASELLRRGPPQKEGWGQDRLGSEEEVDEDLTVDESSQDSPPSQASLTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPADFFSKVSAE
• Target-Kategorie: Mapt