Recombinant Human Neprilysin (MME), partial, Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Neprilysin (MME), partial, Unconjugated
• Artikelnummer: BIM-RPC24818
• Hersteller Artikelnummer: RPC24818
• Alternativnummer: BIM-RPC24818-20UG, BIM-RPC24818-100UG, BIM-RPC24818-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: AtriopeptidaseCommon acute lymphocytic leukemia antigen, CALLAEnkephalinaseNeutral endopeptidase 24.11, NEP, Neutral endopeptidase, Skin fibroblast elastase, SFE, CD10

Produktbeschreibung

Recombinant Human Neprilysin (MME), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MME. Target Synonyms: AtriopeptidaseCommon acute

Produkteigenschaften

• Molekulargewicht: 81.8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTL
• Target-Kategorie: MME