Recombinant Human Oxytocin-neurophysin 1 (OXT), partial, Unconjugated

Artikelnummer: BIM-RPC24858
Artikelname: Recombinant Human Oxytocin-neurophysin 1 (OXT), partial, Unconjugated
Artikelnummer: BIM-RPC24858
Hersteller Artikelnummer: RPC24858
Alternativnummer: BIM-RPC24858-20UG, BIM-RPC24858-100UG, BIM-RPC24858-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Ocytocin
Recombinant Human Oxytocin-neurophysin 1 (OXT), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: OXT. Target Synonyms: Ocytocin. Acces
Molekulargewicht: 11.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Target-Kategorie: OXT