Recombinant Staphylococcus aureus Peptide deformylase (def), Unconjugated

Produktübersicht

• Artikelname: Recombinant Staphylococcus aureus Peptide deformylase (def), Unconjugated
• Artikelnummer: BIM-RPC24868
• Hersteller Artikelnummer: RPC24868
• Alternativnummer: BIM-RPC24868-20UG, BIM-RPC24868-100UG, BIM-RPC24868-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Bacteria
• Konjugation: Unconjugated
• Alternative Synonym: Polypeptide deformylase

Produktbeschreibung

Recombinant Staphylococcus aureus Peptide deformylase (def) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: def. Target Synonyms: Polypeptid

Produkteigenschaften

• Molekulargewicht: 22.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV
• Target-Kategorie: def