Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1), Unconjugated

Artikelnummer: BIM-RPC24871
Artikelname: Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1), Unconjugated
Artikelnummer: BIM-RPC24871
Hersteller Artikelnummer: RPC24871
Alternativnummer: BIM-RPC24871-20UG, BIM-RPC24871-100UG, BIM-RPC24871-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Phosphohistidine phosphatase 1, Protein janus-A homolog
Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PHPT1. Target Synonyms: Phosphoh
Molekulargewicht: 15.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Target-Kategorie: PHPT1