Recombinant Human Elafin (PI3), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Elafin (PI3), Unconjugated
• Artikelnummer: BIM-RPC24872
• Hersteller Artikelnummer: RPC24872
• Alternativnummer: BIM-RPC24872-20UG, BIM-RPC24872-100UG, BIM-RPC24872-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Elastase-specific inhibitor, ESIPeptidase inhibitor 3, PI-3, Protease inhibitor WAP3Skin-derived antileukoproteinase, SKALPWAP four-disulfide core domain protein 14

Produktbeschreibung

Recombinant Human Elafin (PI3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PI3. Target Synonyms: Elastase-specific inhibitor, ESIPeptidas

Produkteigenschaften

• Molekulargewicht: 8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
• Target-Kategorie: PI3