Recombinant Human Cardiac phospholamban (PLN), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Cardiac phospholamban (PLN), Unconjugated
• Artikelnummer: BIM-RPC24881
• Hersteller Artikelnummer: RPC24881
• Alternativnummer: BIM-RPC24881-20UG, BIM-RPC24881-100UG, BIM-RPC24881-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Cardiac phospholamban, CMD1P, CMH18, PLB, Pln, PPLA_HUMAN

Produktbeschreibung

Recombinant Human Cardiac phospholamban (PLN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PLN. Target Synonyms: Cardiac phospholamban, CM

Produkteigenschaften

• Molekulargewicht: 33.1kDa
• Tag: N-Terminal Gst-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
• Target-Kategorie: PLN