Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME), Unconjugated

Artikelnummer: BIM-RPC24889
Artikelname: Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME), Unconjugated
Artikelnummer: BIM-RPC24889
Hersteller Artikelnummer: RPC24889
Alternativnummer: BIM-RPC24889-20UG, BIM-RPC24889-100UG, BIM-RPC24889-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Opa-interacting protein 4, OIP-4Preferentially expressed antigen of melanoma
Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PRAME. Target S
Molekulargewicht: 59.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSP
Target-Kategorie: PRAME