Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial, Unconjugated

Artikelnummer: BIM-RPC24905
Artikelname: Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial, Unconjugated
Artikelnummer: BIM-RPC24905
Hersteller Artikelnummer: RPC24905
Alternativnummer: BIM-RPC24905-20UG, BIM-RPC24905-100UG, BIM-RPC24905-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Vascular endothelial protein tyrosine phosphataseVE-PTP
Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PTPRB. Tar
Molekulargewicht: 43.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPG
Target-Kategorie: PTPRB