Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct), Unconjugated

Artikelnummer: BIM-RPC24911
Artikelname: Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct), Unconjugated
Artikelnummer: BIM-RPC24911
Hersteller Artikelnummer: RPC24911
Alternativnummer: BIM-RPC24911-20UG, BIM-RPC24911-100UG, BIM-RPC24911-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Glutaminyl cyclase
Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Qpct. Target Synonyms: Glutaminy
Molekulargewicht: 39.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHS
Target-Kategorie: Qpct