Recombinant Human Recoverin (RCVRN), Unconjugated

Artikelnummer: BIM-RPC24916
Artikelname: Recombinant Human Recoverin (RCVRN), Unconjugated
Artikelnummer: BIM-RPC24916
Hersteller Artikelnummer: RPC24916
Alternativnummer: BIM-RPC24916-20UG, BIM-RPC24916-100UG, BIM-RPC24916-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cancer-associated retinopathy proteinProtein CAR
Recombinant Human Recoverin (RCVRN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RCVRN. Target Synonyms: Cancer-associated retinopathy pro
Molekulargewicht: 25kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Target-Kategorie: RCVRN