Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated

Produktübersicht

• Artikelname: Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated
• Artikelnummer: BIM-RPC24933
• Hersteller Artikelnummer: RPC24933
• Alternativnummer: BIM-RPC24933-20UG, BIM-RPC24933-100UG, BIM-RPC24933-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Feline
• Konjugation: Unconjugated
• Alternative Synonym: Amyloid fibril protein AACurated

Produktbeschreibung

Recombinant Cat Serum amyloid A protein (SAA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Felis catus (Cat) (Felis silvestris catus). Target Name: SAA1. Target Sy

Produkteigenschaften

• Molekulargewicht: 12.1kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
• Target-Kategorie: SAA1